PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.15774s0314.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 511aa    MW: 57726.5 Da    PI: 9.3553
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.15774s0314.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B381.67.8e-2624125199
                           EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                           f k+lt sd++++g l++p+k+a+++     ++++  +++   +d++g++W +k+++r+k++r++lt+GW+ Fv a++L +gD++vF  
  Bostr.15774s0314.2.p  24 FTKILTASDTSTHGGLSIPRKHATNClppldMSIPIPTQEFLTKDLHGKEWGFKHSFRGKPRRHLLTTGWSAFVTAKRLVAGDVFVFL- 111
                           89*********************999****9445555568999*********************************************. PP

                           -SSSEE..EEEEE-S CS
                    B3  85 dgrsefelvvkvfrk 99 
                            + +++el+v+++r+
  Bostr.15774s0314.2.p 112 -RGETGELRVGIRRA 125
                           .449999*****996 PP

2Auxin_resp103.23.1e-34150229183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha++++++F+vvY+Pr+  s+Fvv+++k+++a+++k+ vG+Rf m+fe+ed+serr+sGt++gv+++++ +W++S+WrsL+
  Bostr.15774s0314.2.p 150 AMHAFDNQCMFTVVYKPRT--SQFVVSYDKFLDAMNNKFNVGSRFTMRFEGEDFSERRYSGTIIGVNNFSS-HWKDSEWRSLQ 229
                           789***************6..9**********************************************888.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-3818137IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-3122131IPR015300DNA-binding pseudobarrel domain
CDDcd100174.97E-2523124No hitNo description
SMARTSM010192.2E-2424126IPR003340B3 DNA binding domain
PROSITE profilePS5086313.91624126IPR003340B3 DNA binding domain
PfamPF023621.2E-2324125IPR003340B3 DNA binding domain
PfamPF065075.6E-31150229IPR010525Auxin response factor
PfamPF023095.0E-7404451IPR033389AUX/IAA domain
SuperFamilySSF542772.75E-12411491No hitNo description
PROSITE profilePS5174524.619415496IPR000270PB1 domain
PfamPF023092.0E-6454499IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MPDTTQVKVS TQNNNNYRPI VNSFTKILTA SDTSTHGGLS IPRKHATNCL PPLDMSIPIP  60
TQEFLTKDLH GKEWGFKHSF RGKPRRHLLT TGWSAFVTAK RLVAGDVFVF LRGETGELRV  120
GIRRAGHQEG NISSSLVSME SMRHGVIASA MHAFDNQCMF TVVYKPRTSQ FVVSYDKFLD  180
AMNNKFNVGS RFTMRFEGED FSERRYSGTI IGVNNFSSHW KDSEWRSLQV QWDELASFPR  240
RDKVSPWEIE HLTPSSNVLQ SSLLKNKRSR HVNEIGSTSS HLLPPILTQG QEIGQPSMTS  300
PMSIPQLNYR DEIEDAKTPS SLLMSYSVPT MPKSNYNNDQ MVTPIKENIT TVAGASCRLF  360
GVSLATPSYI KDPMEPNDSN QISEFSKISQ EKKFDLTQTL TSPKEIQSKQ FSSTRSYTKV  420
QMQGVTIGRA LDLSVLNGYD QLIRELEKLF DLKGLLRTRN QWEIVFTDNE GDMMLVGDDP  480
WPEFRNMVKK IIICSKEEVK NLKSGNNLSN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B3e-9621252121355Auxin response factor 1
4ldx_A3e-9621252121355Auxin response factor 1
4ldw_B3e-9621252121355Auxin response factor 1
4ldw_A3e-9621252121355Auxin response factor 1
4ldv_A3e-9621252121355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478873.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7KK630.0D7KK63_ARALL; Auxin response factor
STRINGfgenesh1_pg.C_scaffold_10030680.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14